Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 34 (TVA34)

This Recombinant Human T cell receptor alpha variable 34 (TVA34) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 34 TRAV34

UniProt

A0A0B4J273

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QELEQSPQSLIVQEGKNLTINCTSSKTLYGLYWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHAGIYLCGAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZSCAN21, ID (ZSCAN21, ZFP38, ZNF38, Zinc finger and SCAN domain-containing protein 21, Renal carcinoma antigen NY-REN-21, Zinc finger protein 38 homolog) (MaxLight 490) discontinued
044415-ML490 100 µL

ZSCAN21, ID (ZSCAN21, ZFP38, ZNF38, Zinc finger and SCAN domain-containing protein 21, Renal carcinoma antigen NY-REN-21, Zinc finger protein 38 homolog) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant Synechocystis sp. Phosphoenolpyruvate carboxylase (ppc), partial
MBS1227797 Inquire

Recombinant Synechocystis sp. Phosphoenolpyruvate carboxylase (ppc), partial

Sign In for Pricing
View Details
Rabbit Polyclonal HEXB Antibody [Alexa Fluor 488]
NBP3-00084AF488 0.1 mL

Rabbit Polyclonal HEXB Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Human PPAT Pre-designed siRNA Set B
SI012606B 1 Each

Human PPAT Pre-designed siRNA Set B

Sign In for Pricing
View Details
RECQL4 (ATP-Dependent DNA Helicase Q4, DNA Helicase, RecQ-like Type 4, RecQ4, RTS, RecQ Protein-like 4, RECQ4) discontinued
225510-01 50 µL

RECQL4 (ATP-Dependent DNA Helicase Q4, DNA Helicase, RecQ-like Type 4, RecQ4, RTS, RecQ Protein-like 4, RECQ4) discontinued

Sign In for Pricing
View Details
RECQL4 (ATP-Dependent DNA Helicase Q4, DNA Helicase, RecQ-like Type 4, RecQ4, RTS, RecQ Protein-like 4, RECQ4) discontinued
225510-02 100 µL

RECQL4 (ATP-Dependent DNA Helicase Q4, DNA Helicase, RecQ-like Type 4, RecQ4, RTS, RecQ Protein-like 4, RECQ4) discontinued

Sign In for Pricing
View Details