Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 20 (TVA20)

This Recombinant Human T cell receptor alpha variable 20 (TVA20) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 20 TRAV20

UniProt

A0A0B4J274

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stk19 Mouse Gene Knockout Kit (CRISPR)
KN516872 1 Kit

Stk19 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Prostaglandin I2 Receptor (PTGIR) (NM_000960) Human Over-expression Lysate
LY400346 100 µg

Prostaglandin I2 Receptor (PTGIR) (NM_000960) Human Over-expression Lysate

Sign In for Pricing
View Details
CDK1 (NM_001786) Human Over-expression Lysate
LY400676 100 µg

CDK1 (NM_001786) Human Over-expression Lysate

Sign In for Pricing
View Details
Oripavine
TRC-O675000-25MG 25 mg

Oripavine

Sign In for Pricing
View Details
PREX1 (C-term) Rabbit Polyclonal Antibody
AP53441PU-N 400 µL

PREX1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(E/Z)-Geranylacetone
TRC-G367778-50G 50 g

(E/Z)-Geranylacetone

Sign In for Pricing
View Details