Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 20 (TVA20)

This Recombinant Human T cell receptor alpha variable 20 (TVA20) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 20 TRAV20

UniProt

A0A0B4J274

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF7 (NM_001572) Human Recombinant Protein
TP317934 20 µg

IRF7 (NM_001572) Human Recombinant Protein

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
BNC470225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
8-Azaguanine(10 mM in DMSO)
TRC-KIT4163-1X1ML 1 mL

8-Azaguanine(10 mM in DMSO)

Sign In for Pricing
View Details
Tissue Total RNA, Chest wall
CR559359 5 µg

Tissue Total RNA, Chest wall

Sign In for Pricing
View Details
Human PCF11 activation kit by CRISPRa
GA109886 1 Kit

Human PCF11 activation kit by CRISPRa

Sign In for Pricing
View Details
Chromogranin A (CHGA/413), CF594 conjugate, 0.1mg/mL
BNC940413-100 1x 100 µL

Chromogranin A (CHGA/413), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details