Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 25 (TVA25)

This Recombinant Human T cell receptor alpha variable 25 (TVA25) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 25 TRAV25

UniProt

A0A0B4J276

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQVMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIQLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta crystallin S (CRYGS) (NM_017541) Human Tagged ORF Clone Lentiviral Particle
RC210159L4V 200 µL

Beta crystallin S (CRYGS) (NM_017541) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CALM3 (CALML2, CAM3, CAMC, CAMIII) discontinued
507590 100 µg

CALM3 (CALML2, CAM3, CAMC, CAMIII) discontinued

Sign In for Pricing
View Details
TH Antibody - N-terminal region : Biotin (AVARP01052_P050-Biotin)
AVARP01052_P050-Biotin 100 µL

TH Antibody - N-terminal region : Biotin (AVARP01052_P050-Biotin)

Sign In for Pricing
View Details
RALGPS2 siRNA Oligos set (Human)
38466171 3x 5 nmol

RALGPS2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
HRT2 shRNA (r) shRNA Lentiviral Particles
sc-270502-V 200 µL

HRT2 shRNA (r) shRNA Lentiviral Particles

Sign In for Pricing
View Details
RPS27L sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
42371111 3x 1.0 µg

RPS27L sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details