Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 25 (TVA25)

This Recombinant Human T cell receptor alpha variable 25 (TVA25) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 25 TRAV25

UniProt

A0A0B4J276

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQVMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIQLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SPNS2 (NM_001124758) AAV Particle
RC225940A1V 250 µL

Human SPNS2 (NM_001124758) AAV Particle

Sign In for Pricing
View Details
Recombinant Human TPSD1 Protein, N-His
bs-102478P-01 20 µg

Recombinant Human TPSD1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TPSD1 Protein, N-His
bs-102478P-02 50 µg

Recombinant Human TPSD1 Protein, N-His

Sign In for Pricing
View Details
TNIP1 Rabbit Polyclonal Antibody (FITC)
orb461634 100 µL

TNIP1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
RARB Rabbit pAb, Pacific Blue conjugated
orb2851381 100 µL

RARB Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
SMARCA3 Rabbit Polyclonal Antibody (FITC)
orb2129397 100 µL

SMARCA3 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details