Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 22 (TVA22)

This Recombinant Human T cell receptor alpha variable 22 (TVA22) spans the amino acid sequence from region 22-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 22 TRAV22

UniProt

A0A0B4J277

Expression Region

22-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IQVEQSPPDLILQEGANSTLRCNFSDSVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTTDSGVYFCAVE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acaa1b (NM_146230) Mouse Tagged ORF Clone
MR206761 10 µg

Acaa1b (NM_146230) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Guinea Pig ADP ribosylation factor like protein 6 interacting protein 6 (ARL6IP6) ELISA Kit
GTR10321199 96 Well

Guinea Pig ADP ribosylation factor like protein 6 interacting protein 6 (ARL6IP6) ELISA Kit

Sign In for Pricing
View Details
GTF2A1L 3'UTR Lenti-reporter-Luc Vector
22783081 1.0 µg

GTF2A1L 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Innovative Grade US Origin Porcine Heart Qty 3
IGPCHT3 3 Units

Innovative Grade US Origin Porcine Heart Qty 3

Sign In for Pricing
View Details
CABYR Rabbit Polyclonal Antibody (HRP)
orb2107367 100 µL

CABYR Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
ALB Antibody, FITC conjugated
A12353-100UG 100 µg

ALB Antibody, FITC conjugated

Sign In for Pricing
View Details