Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 22 (TVA22)

This Recombinant Human T cell receptor alpha variable 22 (TVA22) spans the amino acid sequence from region 22-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 22 TRAV22

UniProt

A0A0B4J277

Expression Region

22-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IQVEQSPPDLILQEGANSTLRCNFSDSVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTTDSGVYFCAVE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TESK2 Protein Lysate 20ug
IHUTESK2PLLY20UG 20 µg

Human TESK2 Protein Lysate 20ug

Sign In for Pricing
View Details
Rabbit Polyclonal ART3 Antibody [DyLight 594]
NBP3-00144DL594 0.1 mL

Rabbit Polyclonal ART3 Antibody [DyLight 594]

Sign In for Pricing
View Details
IHC-Tek HRP Anti-Goat Polymer Detection Kit, Ready To Use
SV0003-1 10 mL

IHC-Tek HRP Anti-Goat Polymer Detection Kit, Ready To Use

Sign In for Pricing
View Details
CD180 Rabbit pAb
MBS8540523-01 0.1 mL

CD180 Rabbit pAb

Sign In for Pricing
View Details
CD180 Rabbit pAb
MBS8540523-02 0.1 mL (AF405L)

CD180 Rabbit pAb

Sign In for Pricing
View Details
CD180 Rabbit pAb
MBS8540523-03 0.1 mL (AF405S)

CD180 Rabbit pAb

Sign In for Pricing
View Details