Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 22 (TVA22)

This Recombinant Human T cell receptor alpha variable 22 (TVA22) spans the amino acid sequence from region 22-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 22 TRAV22

UniProt

A0A0B4J277

Expression Region

22-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IQVEQSPPDLILQEGANSTLRCNFSDSVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTTDSGVYFCAVE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Polyclonal CBFB Antibody
H00000865-B01P 0.05 mg

Mouse Polyclonal CBFB Antibody

Sign In for Pricing
View Details
Rabbit Cytochrome-C ELISA Kit
GTR10370072 96 Well

Rabbit Cytochrome-C ELISA Kit

Sign In for Pricing
View Details
KCNMA1 (NM_002247) Human Over-expression Lysate
LS003778-20ug 20 µg

KCNMA1 (NM_002247) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant STX16 Antibody
RC-4704-01 50 μL

Recombinant STX16 Antibody

Sign In for Pricing
View Details
Recombinant STX16 Antibody
RC-4704-02 100 µL

Recombinant STX16 Antibody

Sign In for Pricing
View Details
Recombinant STX16 Antibody
RC-4704-03 1 mL

Recombinant STX16 Antibody

Sign In for Pricing
View Details