Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 21 (TVA21)

This Recombinant Human T cell receptor alpha variable 21 (TVA21) spans the amino acid sequence from region 20-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 21 TRAV21

UniProt

A0A0B4J279

Expression Region

20-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CES2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0436105 3x 1.0 µg

CES2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Interleukin-36 Gamma Human Recombinant, His Tag
rAP-0658 1 Each

Interleukin-36 Gamma Human Recombinant, His Tag

Sign In for Pricing
View Details
YWHAZ (FITC)
581798-01 50 µg

YWHAZ (FITC)

Sign In for Pricing
View Details
YWHAZ (FITC)
581798-02 100 µg

YWHAZ (FITC)

Sign In for Pricing
View Details
APOC1 ELISA Kit (Human) : 96 Wells (OKEH00339)
OKEH00339 96 Well

APOC1 ELISA Kit (Human) : 96 Wells (OKEH00339)

Sign In for Pricing
View Details
IFluor® 660 Anti-non-human primates/ human CD35 Antibody *E11*
103500G0-AAT 100 Tests

IFluor® 660 Anti-non-human primates/ human CD35 Antibody *E11*

Sign In for Pricing
View Details