Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 21 (TVA21)

This Recombinant Human T cell receptor alpha variable 21 (TVA21) spans the amino acid sequence from region 20-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 21 TRAV21

UniProt

A0A0B4J279

Expression Region

20-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC3A2 Protein (N-His, Rat)
P528525 100 µg

SLC3A2 Protein (N-His, Rat)

Sign In for Pricing
View Details
HMGB3P7 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV763072 1.0 µg DNA

HMGB3P7 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Human Protease, Serine 1 (PRSS1) ELISA Kit
RDR-PRSS1-Hu-48Tests 48 Tests

Human Protease, Serine 1 (PRSS1) ELISA Kit

Sign In for Pricing
View Details
PDCL2 Protein Lysate (Mouse) with C-HA Tag
36269034 100 µg

PDCL2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
CSNK1E Antibody
CSB-PA01319A0Rb-01 50 µg

CSNK1E Antibody

Sign In for Pricing
View Details
CSNK1E Antibody
CSB-PA01319A0Rb-02 100 µg

CSNK1E Antibody

Sign In for Pricing
View Details