Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 21 (TVA21)

This Recombinant Human T cell receptor alpha variable 21 (TVA21) spans the amino acid sequence from region 20-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 21 TRAV21

UniProt

A0A0B4J279

Expression Region

20-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CITED2 Recombinant Antibody
bsm-61361R-01 20 µL

CITED2 Recombinant Antibody

Sign In for Pricing
View Details
CITED2 Recombinant Antibody
bsm-61361R-02 100 µL

CITED2 Recombinant Antibody

Sign In for Pricing
View Details
HS6ST3 antibody - C-terminal region
MBS3209321-01 0.1 mL

HS6ST3 antibody - C-terminal region

Sign In for Pricing
View Details
HS6ST3 antibody - C-terminal region
MBS3209321-02 5x 0.1 mL

HS6ST3 antibody - C-terminal region

Sign In for Pricing
View Details
Vxn Rat shRNA Lentiviral Particle (Locus ID 500393)
TL707763V 500 µL Each

Vxn Rat shRNA Lentiviral Particle (Locus ID 500393)

Sign In for Pricing
View Details
UBXN1 Antibody - C-terminal
MBS3220057-01 0.1 mL

UBXN1 Antibody - C-terminal

Sign In for Pricing
View Details