Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-4 (TVBL4)

This Recombinant Human T cell receptor beta variable 12-4 (TVBL4) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-4 TRBV12-4

UniProt

A0A0B4J2E0

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIQSPRHEVTEMGQEVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCS1 (MOGS) Human shRNA Plasmid Kit (Locus ID 7841)
TL315593 1 Kit

GCS1 (MOGS) Human shRNA Plasmid Kit (Locus ID 7841)

Sign In for Pricing
View Details
GnRH I (A-4) : m-IgGκ BP-HRP Bundle
sc-522101 1 Kit

GnRH I (A-4) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
RNMTL1 shRNA (h) Lentiviral Particles
sc-93988-V 200 µL

RNMTL1 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Kdm2b (NM_013910) Mouse Tagged ORF Clone Lentiviral Particle
MR210589L4V 200 µL

Kdm2b (NM_013910) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Taq 2X PCR Master Mix with Dye
RK20604 500 Reactions

Taq 2X PCR Master Mix with Dye

Sign In for Pricing
View Details
EMSY Knockout jurkat Polyclonal Cells
ARG13113 1 Million

EMSY Knockout jurkat Polyclonal Cells

Sign In for Pricing
View Details