Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D)

This Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69D IGHV1-69D

UniProt

A0A0B4J2H0

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC634142 Mouse siRNA Oligo Duplex (Locus ID 634142)
SR420650 1 Kit

LOC634142 Mouse siRNA Oligo Duplex (Locus ID 634142)

Sign In for Pricing
View Details
ER81 (ETV1) (NM_004956) Human Recombinant Protein
TP310533L 1 mg

ER81 (ETV1) (NM_004956) Human Recombinant Protein

Sign In for Pricing
View Details
Lentiviral mouse Lgals1 shRNA (UAS) - Lentiviral mouse Lgals1 shRNA (UAS) plasmid
GTR15215467 1 Vial

Lentiviral mouse Lgals1 shRNA (UAS) - Lentiviral mouse Lgals1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
(5S,6S) -6-Amino-5-hydroxycyclohexa- 1,3-dienecarboxylic acid
NBA12717-01 5 mg

(5S,6S) -6-Amino-5-hydroxycyclohexa- 1,3-dienecarboxylic acid

Sign In for Pricing
View Details
(5S,6S) -6-Amino-5-hydroxycyclohexa- 1,3-dienecarboxylic acid
NBA12717-02 10 mg

(5S,6S) -6-Amino-5-hydroxycyclohexa- 1,3-dienecarboxylic acid

Sign In for Pricing
View Details
(5S,6S) -6-Amino-5-hydroxycyclohexa- 1,3-dienecarboxylic acid
NBA12717-03 25 mg

(5S,6S) -6-Amino-5-hydroxycyclohexa- 1,3-dienecarboxylic acid

Sign In for Pricing
View Details