Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D)

This Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69D IGHV1-69D

UniProt

A0A0B4J2H0

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf51 Protein Vector (Human) (pPM-C-HA)
14206021 500 ng

C1orf51 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rabl2 Protein Lysate (Mouse) with C-HA Tag
38387034 100 µg

Rabl2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
DDRGK1 Rabbit Polyclonal Antibody
orb1174770 100 µg

DDRGK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZBTB43 Double Nickase Plasmid (h)
sc-407486-NIC 20 µg

ZBTB43 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Human RERG (NM_001190726) AAV Particle
RC231025A1V 250 µL

Human RERG (NM_001190726) AAV Particle

Sign In for Pricing
View Details
PTS (6-pyruvoyl Tetrahydrobiopterin Synthase, PTP Synthase, PTPS, FLJ97081) (AP)
MBS6391484-01 0.1 mL

PTS (6-pyruvoyl Tetrahydrobiopterin Synthase, PTP Synthase, PTPS, FLJ97081) (AP)

Sign In for Pricing
View Details