Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D)

This Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69D IGHV1-69D

UniProt

A0A0B4J2H0

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dermcidin Antibody
E38QA1560 100 µL

Dermcidin Antibody

Sign In for Pricing
View Details
KLRC1 antibody
70R-10285 50 ug

KLRC1 antibody

Sign In for Pricing
View Details
Biotin-PEG2-amine
571996 100.0mg

Biotin-PEG2-amine

Sign In for Pricing
View Details
NCAM2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-11094R-BF555 100 µL

NCAM2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Frozen Tissue Sections, Testis
CS600070 5x 5 µm

Frozen Tissue Sections, Testis

Sign In for Pricing
View Details
CHMP6 Antibody
orb1286106 100 µL

CHMP6 Antibody

Sign In for Pricing
View Details