Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 6-21 (KV621)

This Recombinant Human Immunoglobulin kappa variable 6-21 (KV621) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 6-21 IGKV6-21

UniProt

A0A0C4DH24

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSFSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCHQSSSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C1orf105 activation kit by CRISPRa
GA114210 1 Kit

Human C1orf105 activation kit by CRISPRa

Sign In for Pricing
View Details
SMUG1 Mouse Monoclonal Antibody [Clone ID: OTI6B3]
CF810367 100 µg

SMUG1 Mouse Monoclonal Antibody [Clone ID: OTI6B3]

Sign In for Pricing
View Details
ARMH4 Human Gene Knockout Kit (CRISPR)
KN415970 1 Kit

ARMH4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Aurora B (AURKB) Rabbit Polyclonal Antibody
AP06627PU-N 100 µg

Aurora B (AURKB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PD-L1 Antibody
OC-277-01 50 μL

PD-L1 Antibody

Sign In for Pricing
View Details
PD-L1 Antibody
OC-277-02 100 µL

PD-L1 Antibody

Sign In for Pricing
View Details