Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 6-21 (KV621)

This Recombinant Human Immunoglobulin kappa variable 6-21 (KV621) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 6-21 IGKV6-21

UniProt

A0A0C4DH24

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSFSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCHQSSSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tpit (TBX19) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C9]
TA800675AM 100 µL

Tpit (TBX19) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C9]

Sign In for Pricing
View Details
SGK3 (NM_001033578) Human Over-expression Lysate
LY422403 100 µg

SGK3 (NM_001033578) Human Over-expression Lysate

Sign In for Pricing
View Details
ASB16-AS1 Human qPCR Primer Pair (NM_178542)
HP218867 200 Reactions

ASB16-AS1 Human qPCR Primer Pair (NM_178542)

Sign In for Pricing
View Details
Distillation Tester (Low-temperature) BPTL-247
BPTL-247 1 Unit

Distillation Tester (Low-temperature) BPTL-247

Sign In for Pricing
View Details
Cystathionase (CTH) (NM_001902) Human Over-expression Lysate
LC419669 20 µg

Cystathionase (CTH) (NM_001902) Human Over-expression Lysate

Sign In for Pricing
View Details
MHC Class I H-2 Kb / H-2 Db Mouse Monoclonal Antibody [Clone ID: 5041.16.1]
CL058P 250 µg

MHC Class I H-2 Kb / H-2 Db Mouse Monoclonal Antibody [Clone ID: 5041.16.1]

Sign In for Pricing
View Details