Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 6-21 (KV621)

This Recombinant Human Immunoglobulin kappa variable 6-21 (KV621) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 6-21 IGKV6-21

UniProt

A0A0C4DH24

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSFSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCHQSSSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCT4P1 Protein Vector (Human) (pPB-N-His)
PV068106 500 ng

CCT4P1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CHST2 siRNA (Mouse)
MBS8224165-01 15 nmol

CHST2 siRNA (Mouse)

Sign In for Pricing
View Details
CHST2 siRNA (Mouse)
MBS8224165-02 30 nmol

CHST2 siRNA (Mouse)

Sign In for Pricing
View Details
CHST2 siRNA (Mouse)
MBS8224165-03 5x 30 nmol

CHST2 siRNA (Mouse)

Sign In for Pricing
View Details
EmL4 Mouse siRNA Oligo Duplex (Locus ID 78798)
SR421305 1 Kit

EmL4 Mouse siRNA Oligo Duplex (Locus ID 78798)

Sign In for Pricing
View Details
GPR155 Polyclonal Conjugated Antibody
MBS9440938-01 0.1 mL (Biotin)

GPR155 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details