Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-20 (KVD20)

This Recombinant Human Immunoglobulin kappa variable 3D-20 (KVD20) spans the amino acid sequence from region 21-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-20 IGKV3D-20

UniProt

A0A0C4DH25

Expression Region

21-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPATLSLSPGERATLSCGASQSVSSSYLAWYQQKPGLAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ZNF238 Protein - (Dry Ice)
H00010472-P01-2ug 2 µg

Recombinant Human ZNF238 Protein - (Dry Ice)

Sign In for Pricing
View Details
Mouse L-phenylalanine, LPA ELISA Kit
YLA0788MO-01 48 Tests

Mouse L-phenylalanine, LPA ELISA Kit

Sign In for Pricing
View Details
Mouse L-phenylalanine, LPA ELISA Kit
YLA0788MO-02 96 Tests

Mouse L-phenylalanine, LPA ELISA Kit

Sign In for Pricing
View Details
FAM47E Protein Vector (Mouse) (pPB-N-His)
PV177899 500 ng

FAM47E Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Anti-MKK4 Antibody
MBS8242055-01 0.03 mL

Anti-MKK4 Antibody

Sign In for Pricing
View Details
Anti-MKK4 Antibody
MBS8242055-02 0.05 mL

Anti-MKK4 Antibody

Sign In for Pricing
View Details