Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 8 (TRGV8)

This Recombinant Human T cell receptor gamma variable 8 (TRGV8) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 8 TRGV8 TCRGV8

UniProt

A0A0C4DH27

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVTRPTGSSAVITCDLPVENAVYTHWYLHQEGKAPQRLLYYDSYNSRVVLESGISREKYHTYASTGKSLKFILENLIERDSGVYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Defb19 (NM_145157) Mouse Tagged ORF Clone
MG200167 10 µg

Defb19 (NM_145157) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CMT (ICMT) (C-term) Rabbit Polyclonal Antibody
AP12275PU-N 400 µL

CMT (ICMT) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KChIP2 (KCNIP2) Mouse Monoclonal Antibody [Clone ID: OTI3C4]
CF807370 100 µg

KChIP2 (KCNIP2) Mouse Monoclonal Antibody [Clone ID: OTI3C4]

Sign In for Pricing
View Details
Tas2r108 Mouse Gene Knockout Kit (CRISPR)
KN517195 1 Kit

Tas2r108 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-Ethoxy-1,2-propanediol
TRC-E892770-5G 5 g

3-Ethoxy-1,2-propanediol

Sign In for Pricing
View Details
Reg2 Mouse Gene Knockout Kit (CRISPR)
KN514649 1 Kit

Reg2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details