Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 4 (TRGV4)

This Recombinant Human T cell receptor gamma variable 4 (TRGV4) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 4 TRGV4 TCRGV4

UniProt

A0A0C4DH28

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVIRQTGSSAEITCDLAEGSTGYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISPGKYDTYGSTRKNLRMILRNLIENDSGVYYCATWDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYSMD4 Protein Vector (Mouse) (pPB-N-His)
PV198423 500 ng

LYSMD4 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Olfr583 Mouse shRNA Lentiviral Particle (Locus ID 258752)
TL507886V 500 µL Each

Olfr583 Mouse shRNA Lentiviral Particle (Locus ID 258752)

Sign In for Pricing
View Details
Rat Mustn1 Pre-designed siRNA Set B
SI208864B 1 Each

Rat Mustn1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Cxcl10 Rat Pre-designed siRNA Set A
HY-RS22949 1 Set

Cxcl10 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
NDFIP2 (NEDD4 Family-interacting Protein 2, NEDD4 WW Domain-binding Protein 5A, Putative MAPK-activating Protein PM04/PM05/PM06/PM07, Putative NF-kappa-B-activating Protein 413, KIAA1165, N4WBP5A, FLJ25842)
130190 50 µg

NDFIP2 (NEDD4 Family-interacting Protein 2, NEDD4 WW Domain-binding Protein 5A, Putative MAPK-activating Protein PM04/PM05/PM06/PM07, Putative NF-kappa-B-activating Protein 413, KIAA1165, N4WBP5A, FLJ25842)

Sign In for Pricing
View Details
PENK siRNA Oligos set (Human)
36385171 3x 5 nmol

PENK siRNA Oligos set (Human)

Sign In for Pricing
View Details