Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 4 (TRGV4)

This Recombinant Human T cell receptor gamma variable 4 (TRGV4) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 4 TRGV4 TCRGV4

UniProt

A0A0C4DH28

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVIRQTGSSAEITCDLAEGSTGYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISPGKYDTYGSTRKNLRMILRNLIENDSGVYYCATWDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DVL1 Polyclonal Antibody
ANT-11938-50ug 50 µg

DVL1 Polyclonal Antibody

Sign In for Pricing
View Details
Annexin A3, Recombinant, Human (Annexin-3, Lipocortin III, Placental anticoagulant protein III, 35-alpha calcimedin, ANXA3, ANX3)
MBS637195-01 0.1 mg

Annexin A3, Recombinant, Human (Annexin-3, Lipocortin III, Placental anticoagulant protein III, 35-alpha calcimedin, ANXA3, ANX3)

Sign In for Pricing
View Details
Annexin A3, Recombinant, Human (Annexin-3, Lipocortin III, Placental anticoagulant protein III, 35-alpha calcimedin, ANXA3, ANX3)
MBS637195-02 5x 0.1 mg

Annexin A3, Recombinant, Human (Annexin-3, Lipocortin III, Placental anticoagulant protein III, 35-alpha calcimedin, ANXA3, ANX3)

Sign In for Pricing
View Details
eIF3K antibody
MBS9413292-01 0.1 mL

eIF3K antibody

Sign In for Pricing
View Details
eIF3K antibody
MBS9413292-02 5x 0.1 mL

eIF3K antibody

Sign In for Pricing
View Details
Guinea Pig Cbp/p300 interacting transactivator 1 (CITED1) ELISA Kit
GTR10363164 96 Well

Guinea Pig Cbp/p300 interacting transactivator 1 (CITED1) ELISA Kit

Sign In for Pricing
View Details