Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 4 (TRGV4)

This Recombinant Human T cell receptor gamma variable 4 (TRGV4) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 4 TRGV4 TCRGV4

UniProt

A0A0C4DH28

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVIRQTGSSAEITCDLAEGSTGYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISPGKYDTYGSTRKNLRMILRNLIENDSGVYYCATWDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hypoxanthine 99.0% (6-Hydroxypurine) Plant Culture Tested
PCT1206-01 5 g

Hypoxanthine 99.0% (6-Hydroxypurine) Plant Culture Tested

Sign In for Pricing
View Details
Hypoxanthine 99.0% (6-Hydroxypurine) Plant Culture Tested
PCT1206-02 25 g

Hypoxanthine 99.0% (6-Hydroxypurine) Plant Culture Tested

Sign In for Pricing
View Details
Hypoxanthine 99.0% (6-Hydroxypurine) Plant Culture Tested
PCT1206-03 100 g

Hypoxanthine 99.0% (6-Hydroxypurine) Plant Culture Tested

Sign In for Pricing
View Details
(+) -DHMEQ
orb1708117-01 25 mg

(+) -DHMEQ

Sign In for Pricing
View Details
(+) -DHMEQ
orb1708117-02 50 mg

(+) -DHMEQ

Sign In for Pricing
View Details
(+) -DHMEQ
orb1708117-03 100 mg

(+) -DHMEQ

Sign In for Pricing
View Details