Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-3 (HV103)

This Recombinant Human Immunoglobulin heavy variable 1-3 (HV103) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-3 IGHV1-3

UniProt

A0A0C4DH29

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYAMHWVRQAPGQRLEWMGWINAGNGNTKYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APBA3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0102306 1.0 µg DNA

APBA3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
LACRT Antibody
15-642 100 µL

LACRT Antibody

Sign In for Pricing
View Details
LRRC10B CRISPR Activation Plasmid (m)
sc-435522-ACT 20 µg

LRRC10B CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Human PP14/Glycodelin Recombinant Protein
PROTP09466-250ug 250 µg

Human PP14/Glycodelin Recombinant Protein

Sign In for Pricing
View Details
Anti-HMHA1 antibody
PAab03935 100 µg

Anti-HMHA1 antibody

Sign In for Pricing
View Details
C-Fos shRNA Plasmid (bovine)
sc-270565-SH 20 µg

C-Fos shRNA Plasmid (bovine)

Sign In for Pricing
View Details