Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-20 (HV320)

This Recombinant Human Immunoglobulin heavy variable 3-20 (HV320) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-20 IGHV3-20

UniProt

A0A0C4DH32

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGVVRPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVSGINWNGGSTGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYHCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GDAP1L1 activation kit by CRISPRa
GA112298 1 Kit

Human GDAP1L1 activation kit by CRISPRa

Sign In for Pricing
View Details
Glycophorin A / CD235a (Erythrocyte Marker) (N/A), Biotin conjugate, 0.1mg/mL
BNCB1736-100 1x 100 µL

Glycophorin A / CD235a (Erythrocyte Marker) (N/A), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
beta Catenin (CTNNB1) pSer33 Rabbit Polyclonal Antibody
AP20826PU-N 100 µg

beta Catenin (CTNNB1) pSer33 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
c Fos (FOS) Mouse Monoclonal Antibody [Clone ID: OTI7D6]
CF806977 100 µg

c Fos (FOS) Mouse Monoclonal Antibody [Clone ID: OTI7D6]

Sign In for Pricing
View Details
Luminol
TRC-L474450-50G 50 g

Luminol

Sign In for Pricing
View Details
Acid sphingomyelinase (SMPD1) (NM_001007593) Human Over-expression Lysate
LY423515 100 µg

Acid sphingomyelinase (SMPD1) (NM_001007593) Human Over-expression Lysate

Sign In for Pricing
View Details