Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-20 (HV320)

This Recombinant Human Immunoglobulin heavy variable 3-20 (HV320) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-20 IGHV3-20

UniProt

A0A0C4DH32

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGVVRPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVSGINWNGGSTGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYHCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proteasome beta 1 (PSMB1) (NM_002793) Human Over-expression Lysate
LY419103 100 µg

Proteasome beta 1 (PSMB1) (NM_002793) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant PAR2 Antibody
RC-16734-01 50 μL

Recombinant PAR2 Antibody

Sign In for Pricing
View Details
Recombinant PAR2 Antibody
RC-16734-02 100 µL

Recombinant PAR2 Antibody

Sign In for Pricing
View Details
Recombinant PAR2 Antibody
RC-16734-03 1 mL

Recombinant PAR2 Antibody

Sign In for Pricing
View Details
Spastin (Sp 3G11-1), Biotin conjugate, 0.1mg/mL
BNCB2844-500 1x 500 µL

Spastin (Sp 3G11-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Heparan Sulphate Proteoglycan (A7L6), Biotin conjugate, 0.1mg/mL
BNCB0315-500 1x 500 µL

Heparan Sulphate Proteoglycan (A7L6), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details