Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-20 (HV320)

This Recombinant Human Immunoglobulin heavy variable 3-20 (HV320) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-20 IGHV3-20

UniProt

A0A0C4DH32

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGVVRPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVSGINWNGGSTGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYHCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin Conjugated Goat Polyclonal Antibody to Human a-2-Macroglobulin
BAT-2117-2 2 mL

Biotin Conjugated Goat Polyclonal Antibody to Human a-2-Macroglobulin

Sign In for Pricing
View Details
W/W001/FR558-PP-450x150/1-B Safety & Regulatory Compliance Signs (No Adhesive)
139120 1 Pack (1 Panel (s) x 1 Pack)

W/W001/FR558-PP-450x150/1-B Safety & Regulatory Compliance Signs (No Adhesive)

Sign In for Pricing
View Details
TXND5 discontinued
543478-01 30ul

TXND5 discontinued

Sign In for Pricing
View Details
TXND5 discontinued
543478-02 100 µL

TXND5 discontinued

Sign In for Pricing
View Details
Escherichia coli
PCR-VHA207-01 PCR-VHA207-48D

Escherichia coli

Sign In for Pricing
View Details
Escherichia coli
PCR-VHA207-02 PCR-VHA207-96D

Escherichia coli

Sign In for Pricing
View Details