Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-35 IGHV3-35

UniProt

A0A0C4DH35

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDMNWVHQAPGKGLEWVSGVSWNGSRTHYADSVKGRFIISRDNSRNTLYLQTNSLRAEDTAVYYCVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SLC26A6 shRNA (UAS) - Lentiviral human SLC26A6 shRNA (UAS, RFP) (100)
GTR15325347 1 Vial

Lentiviral human SLC26A6 shRNA (UAS) - Lentiviral human SLC26A6 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Recombinant Bordetella Avium minE Protein (aa 1-90)
VAng-Lsx4056-50gEcoli 50 µg (E. coli)

Recombinant Bordetella Avium minE Protein (aa 1-90)

Sign In for Pricing
View Details
SLAP2 (SLA2) (NM_032214) Human 3' UTR Clone
SC214082 10 µg

SLAP2 (SLA2) (NM_032214) Human 3' UTR Clone

Sign In for Pricing
View Details
Kallikrein 8 (KLK8) Mouse Monoclonal Antibody [Clone ID: OTI2A1]
TA506175 100 µL

Kallikrein 8 (KLK8) Mouse Monoclonal Antibody [Clone ID: OTI2A1]

Sign In for Pricing
View Details
hsa-miR-4650-3p Primers
MPH02814 150 µL / 10 µM

hsa-miR-4650-3p Primers

Sign In for Pricing
View Details
AL082D06 5mg
A12194-5 5 mg

AL082D06 5mg

Sign In for Pricing
View Details