Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38 (HV338)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38 (HV338) spans the amino acid sequence from region 20-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38 IGHV3-38

UniProt

A0A0C4DH36

Expression Region

20-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPRGSLRLSCAASGFTVSSNEMSWIRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLYLQMNNLRAEGTAVYYCARY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-DIACETOXYBENZENE
635-67-6 1 Each

1,2-DIACETOXYBENZENE

Sign In for Pricing
View Details
GNL3L Polyclonal Antibody
MBS2536782-01 0.02 mL

GNL3L Polyclonal Antibody

Sign In for Pricing
View Details
GNL3L Polyclonal Antibody
MBS2536782-02 0.06 mL

GNL3L Polyclonal Antibody

Sign In for Pricing
View Details
GNL3L Polyclonal Antibody
MBS2536782-03 0.12 mL

GNL3L Polyclonal Antibody

Sign In for Pricing
View Details
GNL3L Polyclonal Antibody
MBS2536782-04 0.2 mL

GNL3L Polyclonal Antibody

Sign In for Pricing
View Details
Neuroserpin (SERPINI1) (NM_005025) Human Tagged ORF Clone
RG205290 10 µg

Neuroserpin (SERPINI1) (NM_005025) Human Tagged ORF Clone

Sign In for Pricing
View Details