Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 5-51 (HV551)

This Recombinant Human Immunoglobulin heavy variable 5-51 (HV551) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 5-51 IGHV5-51

UniProt

A0A0C4DH38

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha 1 Antitrypsin/SERPINA1 Rabbit Polyclonal Antibody (Fluoro594)
orb3079317 100 µg

Alpha 1 Antitrypsin/SERPINA1 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Human PGLYRP1 Knockout A549 cell line
GTR15418829 1 Vial

Human PGLYRP1 Knockout A549 cell line

Sign In for Pricing
View Details
RPL7AP23 ORF Vector (Human) (pORF)
41798011 1.0 µg DNA

RPL7AP23 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Phortress
MBS5757620 Inquire

Phortress

Sign In for Pricing
View Details
Crcp (NM_007761) Mouse Recombinant Protein
PM48811M5 20 µg

Crcp (NM_007761) Mouse Recombinant Protein

Sign In for Pricing
View Details
CTU2 siRNA (Mouse)
CRM6913-01 15 nmol

CTU2 siRNA (Mouse)

Sign In for Pricing
View Details