Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-61 (HV461)

This Recombinant Human Immunoglobulin heavy variable 4-61 (HV461) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-61 IGHV4-61

UniProt

A0A0C4DH41

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGGSVSSGSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peficitinib 25mg
A14438-25 25 mg

Peficitinib 25mg

Sign In for Pricing
View Details
IRAK2 Rabbit Polyclonal Antibody (Fluoro488)
orb3113609 100 µg

IRAK2 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
SPRR2A Mouse Monoclonal Antibody [Clone ID: OTI1B1]
CF808490 100 µg

SPRR2A Mouse Monoclonal Antibody [Clone ID: OTI1B1]

Sign In for Pricing
View Details
Gm15386 sgRNA CRISPR Lentivector set (Mouse)
K3144101 3x 1.0 µg

Gm15386 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
CLVS2 Human Gene Knockout Kit (CRISPR)
KN419317 1 Kit

CLVS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Naa25 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
31370116 3x 1.0 µg

Naa25 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details