Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-61 (HV461)

This Recombinant Human Immunoglobulin heavy variable 4-61 (HV461) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-61 IGHV4-61

UniProt

A0A0C4DH41

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGGSVSSGSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR4749 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV770271 1.0 µg DNA

MIR4749 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Mouse Monoclonal GARS Antibody (4E10) [Alexa Fluor 750]
NBP2-42679AF750 100 µL

Mouse Monoclonal GARS Antibody (4E10) [Alexa Fluor 750]

Sign In for Pricing
View Details
FAM84A (Protein FAM84A, Neurologic Sensory Protein 1, NSE1, FLJ35392, PP11517) (MaxLight 550)
MBS6211445-01 0.1 mL

FAM84A (Protein FAM84A, Neurologic Sensory Protein 1, NSE1, FLJ35392, PP11517) (MaxLight 550)

Sign In for Pricing
View Details
FAM84A (Protein FAM84A, Neurologic Sensory Protein 1, NSE1, FLJ35392, PP11517) (MaxLight 550)
MBS6211445-02 5x 0.1 mL

FAM84A (Protein FAM84A, Neurologic Sensory Protein 1, NSE1, FLJ35392, PP11517) (MaxLight 550)

Sign In for Pricing
View Details
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI1C7]
CF504481 100 µg

Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: OTI1C7]

Sign In for Pricing
View Details
Transcription Factor E2-Alpha (TCF3) Antibody
abx116154 100 µL

Transcription Factor E2-Alpha (TCF3) Antibody

Sign In for Pricing
View Details