Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-66 (HV366)

This Recombinant Human Immunoglobulin heavy variable 3-66 (HV366) spans the amino acid sequence from region 20-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-66 IGHV3-66

UniProt

A0A0C4DH42

Expression Region

20-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSCGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPM6B Protein Lysate (Mouse) with C-HA Tag
22472034 100 µg

GPM6B Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Mouse Monoclonal LHR Antibody (LHCGR/7399) [Janelia Fluor 525]
NBP3-26966JF525 0.1 mL

Mouse Monoclonal LHR Antibody (LHCGR/7399) [Janelia Fluor 525]

Sign In for Pricing
View Details
PAH, ID (PAH, Phenylalanine-4-hydroxylase, Phe-4-monooxygenase) (MaxLight 550)
MBS6330523-01 0.1 mL

PAH, ID (PAH, Phenylalanine-4-hydroxylase, Phe-4-monooxygenase) (MaxLight 550)

Sign In for Pricing
View Details
PAH, ID (PAH, Phenylalanine-4-hydroxylase, Phe-4-monooxygenase) (MaxLight 550)
MBS6330523-02 5x 0.1 mL

PAH, ID (PAH, Phenylalanine-4-hydroxylase, Phe-4-monooxygenase) (MaxLight 550)

Sign In for Pricing
View Details
Anti-Phospho-ACACA (Ser79) Polyclonal Antibody
TMAC-00066-01 50 μL

Anti-Phospho-ACACA (Ser79) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-ACACA (Ser79) Polyclonal Antibody
TMAC-00066-02 100 µL

Anti-Phospho-ACACA (Ser79) Polyclonal Antibody

Sign In for Pricing
View Details