Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-8 (KV108)

This Recombinant Human Immunoglobulin kappa variable 1-8 (KV108) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-8 IGKV1-8

UniProt

A0A0C4DH67

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIRMTQSPSSFSASTGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISCLQSEDFATYYCQQYYSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Nogo Receptor Rabbit pAb
GB114985-50 50 μL

Anti-Nogo Receptor Rabbit pAb

Sign In for Pricing
View Details
Recombinant Human Tyrosine-protein kinase ABL1 Protein, GST, E.coli-200ug
QP8475-ec-200ug 200ug

Recombinant Human Tyrosine-protein kinase ABL1 Protein, GST, E.coli-200ug

Sign In for Pricing
View Details
CPT2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-52621R-BF405 100 µL

CPT2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
CCDC155 AAV siRNA Pooled Vector
15221161 1.0 µg

CCDC155 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Phospho-PAK1 (Thr423) /PAK2 (Thr402) Antibody Blocking Peptide
orb1505239 500 µg

Phospho-PAK1 (Thr423) /PAK2 (Thr402) Antibody Blocking Peptide

Sign In for Pricing
View Details
Rat C19h1orf198 Pre-designed siRNA Set A
SI201671A 1 Each

Rat C19h1orf198 Pre-designed siRNA Set A

Sign In for Pricing
View Details