Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-8 (KV108)

This Recombinant Human Immunoglobulin kappa variable 1-8 (KV108) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-8 IGKV1-8

UniProt

A0A0C4DH67

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIRMTQSPSSFSASTGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISCLQSEDFATYYCQQYYSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2)
MBS1115717 Inquire

Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2)

Sign In for Pricing
View Details
Vil1 sgRNA CRISPR Lentivector (Human) (Target 2)
K0004503 1.0 µg DNA

Vil1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
AP2A peptide
orb343867 50 µg

AP2A peptide

Sign In for Pricing
View Details
Adss Rat shRNA Lentiviral Particle (Locus ID 289276)
TL704569V 500 µL Each

Adss Rat shRNA Lentiviral Particle (Locus ID 289276)

Sign In for Pricing
View Details
2''-O-Galloylmyricitrin
orb1683744 5 mg

2''-O-Galloylmyricitrin

Sign In for Pricing
View Details
YagN Antibody
orb831655 2 mg

YagN Antibody

Sign In for Pricing
View Details