Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-8 (KV108)

This Recombinant Human Immunoglobulin kappa variable 1-8 (KV108) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-8 IGKV1-8

UniProt

A0A0C4DH67

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIRMTQSPSSFSASTGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISCLQSEDFATYYCQQYYSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tpk1 3'UTR GFP Stable Cell Line
TU170987 1.0 mL

Tpk1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rat Myosin-9 (MYH9) ELISA Kit
RK06444 96 Tests

Rat Myosin-9 (MYH9) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-SmcHDl Antibody, Affinity Purified
A302-871A-T 2 µg

Rabbit anti-SmcHDl Antibody, Affinity Purified

Sign In for Pricing
View Details
Spike Protein (C-His, SARS-CoV-2)
P528623 100 µg

Spike Protein (C-His, SARS-CoV-2)

Sign In for Pricing
View Details
T-26c 50mg
A12853-50 50 mg

T-26c 50mg

Sign In for Pricing
View Details
Anti-Olfactory receptor 8G5 antibody
STJ94809 200 µl

Anti-Olfactory receptor 8G5 antibody

Sign In for Pricing
View Details