Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-24 (KV224)

This Recombinant Human Immunoglobulin kappa variable 2-24 (KV224) spans the amino acid sequence from region 20-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-24 IGKV2-24

UniProt

A0A0C4DH68

Expression Region

20-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDIVMTQTPLSSPVTLGQPASISCRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKISNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQATQFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMH Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV671542 1.0 µg DNA

AMH Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Porcine Cdc42 effector protein 4 (CDC42EP4) ELISA Kit
MBS7251270-01 48 Well

Porcine Cdc42 effector protein 4 (CDC42EP4) ELISA Kit

Sign In for Pricing
View Details
Porcine Cdc42 effector protein 4 (CDC42EP4) ELISA Kit
MBS7251270-02 96 Well

Porcine Cdc42 effector protein 4 (CDC42EP4) ELISA Kit

Sign In for Pricing
View Details
Porcine Cdc42 effector protein 4 (CDC42EP4) ELISA Kit
MBS7251270-03 5x 96 Well

Porcine Cdc42 effector protein 4 (CDC42EP4) ELISA Kit

Sign In for Pricing
View Details
Porcine Cdc42 effector protein 4 (CDC42EP4) ELISA Kit
MBS7251270-04 10x 96 Well

Porcine Cdc42 effector protein 4 (CDC42EP4) ELISA Kit

Sign In for Pricing
View Details
MB Antibody - N-terminal region : Biotin (ARP41558_P050-Biotin)
ARP41558_P050-Biotin 100 µL

MB Antibody - N-terminal region : Biotin (ARP41558_P050-Biotin)

Sign In for Pricing
View Details