Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-24 (KV224)

This Recombinant Human Immunoglobulin kappa variable 2-24 (KV224) spans the amino acid sequence from region 20-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-24 IGKV2-24

UniProt

A0A0C4DH68

Expression Region

20-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDIVMTQTPLSSPVTLGQPASISCRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKISNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQATQFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1110051M20Rik (BC089006) Mouse Tagged ORF Clone
MG204767 10 µg

1110051M20Rik (BC089006) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human MAPK9 protein (His tag)
PDEH100389-01 20 µg

Recombinant Human MAPK9 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human MAPK9 protein (His tag)
PDEH100389-02 100 µg

Recombinant Human MAPK9 protein (His tag)

Sign In for Pricing
View Details
Anti-PLA2G2A Rabbit Monoclonal Antibody
MA4640-.1 100 µL

Anti-PLA2G2A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human Lambda Light Chain (Lambda-IgLC) ELISA Kit
abx055742 96 Well

Human Lambda Light Chain (Lambda-IgLC) ELISA Kit

Sign In for Pricing
View Details
Caspase-1 p20 Rabbit Polyclonal Antibody (PE-Cy7)
orb958323 100 µL

Caspase-1 p20 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details