Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-24 (KV224)

This Recombinant Human Immunoglobulin kappa variable 2-24 (KV224) spans the amino acid sequence from region 20-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-24 IGKV2-24

UniProt

A0A0C4DH68

Expression Region

20-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDIVMTQTPLSSPVTLGQPASISCRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKISNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQATQFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS3A Protein Lysate (Mouse) with C-HA Tag
42496034 100 µg

RPS3A Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
CNR1 sgRNA CRISPR Lentivector (Human) (Target 3)
K0478104 1.0 µg DNA

CNR1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human METTL24 knockdown cell line
ABC-KD9208 1 Vial

Human METTL24 knockdown cell line

Sign In for Pricing
View Details
Streptavidin-HRP Conjugate (EMSA)
CSHE001 60 μL

Streptavidin-HRP Conjugate (EMSA)

Sign In for Pricing
View Details
I/EVP7/NL/RFLB/2.0MPL-400X600-1 Parking, Traffic & Road Signs (No Adhesive)
310307 1 Pack (1 Panel (s) x 1 Pack)

I/EVP7/NL/RFLB/2.0MPL-400X600-1 Parking, Traffic & Road Signs (No Adhesive)

Sign In for Pricing
View Details
Sulfamethazine
S3133-100mg 100 mg

Sulfamethazine

Sign In for Pricing
View Details