Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-9 (KV109)

This Recombinant Human Immunoglobulin kappa variable 1-9 (KV109) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-9 IGKV1-9

UniProt

A0A0C4DH69

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/3132R), 0.2mg/mL
BNUB3132-500 1x 500 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/3132R), 0.2mg/mL

Sign In for Pricing
View Details
rac-1-Nitrosobiotin-D4
TRC-N311991-25MG 25 mg

rac-1-Nitrosobiotin-D4

Sign In for Pricing
View Details
Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit
E-EL-R2554-01 24 Tests

Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit

Sign In for Pricing
View Details
Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit
E-EL-R2554-02 48 Tests

Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit

Sign In for Pricing
View Details
Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit
E-EL-R2554-03 96 Tests

Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit

Sign In for Pricing
View Details
Six2 Mouse Gene Knockout Kit (CRISPR)
KN515812 1 Kit

Six2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details