Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-9 (KV109)

This Recombinant Human Immunoglobulin kappa variable 1-9 (KV109) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-9 IGKV1-9

UniProt

A0A0C4DH69

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Keratin 17 discontinued
K0199-20A 100 µL

Keratin 17 discontinued

Sign In for Pricing
View Details
LOC500956 (NM_001025054) Rat Tagged Lenti ORF Clone
RR213481L3 10 µg

LOC500956 (NM_001025054) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Shewanella sp. UPF0301 protein Sputw3181_1330 (Sputw3181_1330)
MBS1165710-01 0.02 mg (E-Coli)

Recombinant Shewanella sp. UPF0301 protein Sputw3181_1330 (Sputw3181_1330)

Sign In for Pricing
View Details
Recombinant Shewanella sp. UPF0301 protein Sputw3181_1330 (Sputw3181_1330)
MBS1165710-02 0.1 mg (E-Coli)

Recombinant Shewanella sp. UPF0301 protein Sputw3181_1330 (Sputw3181_1330)

Sign In for Pricing
View Details
Recombinant Shewanella sp. UPF0301 protein Sputw3181_1330 (Sputw3181_1330)
MBS1165710-03 0.02 mg (Yeast)

Recombinant Shewanella sp. UPF0301 protein Sputw3181_1330 (Sputw3181_1330)

Sign In for Pricing
View Details
Recombinant Shewanella sp. UPF0301 protein Sputw3181_1330 (Sputw3181_1330)
MBS1165710-04 0.1 mg (Yeast)

Recombinant Shewanella sp. UPF0301 protein Sputw3181_1330 (Sputw3181_1330)

Sign In for Pricing
View Details