Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-12 (KV112)

This Recombinant Human Immunoglobulin kappa variable 1-12 (KV112) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-12 IGKV1-12

UniProt

A0A0C4DH73

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

β-Amyloid (D3D2N) & CO-0119-647 SignalStar™ Oligo-Antibody Pair
CST 85006S 1 Kit

β-Amyloid (D3D2N) & CO-0119-647 SignalStar™ Oligo-Antibody Pair

Sign In for Pricing
View Details
Briakinumab
E40YR1099 1 mg

Briakinumab

Sign In for Pricing
View Details
NARG1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-19020R-BF647 100 µL

NARG1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
SCNG-03-GRS AB Labels
332989 Pack of 300 Piece(s)

SCNG-03-GRS AB Labels

Sign In for Pricing
View Details
LYG1 Protein Vector (Human) (pPM-C-HA)
27832021 500 ng

LYG1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CBX6 Antibody
MBS9504892-01 0.05 mL

CBX6 Antibody

Sign In for Pricing
View Details