Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-12 (KV112)

This Recombinant Human Immunoglobulin kappa variable 1-12 (KV112) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-12 IGKV1-12

UniProt

A0A0C4DH73

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF5L Peptide
MBS3226053-01 0.1 mg

TAF5L Peptide

Sign In for Pricing
View Details
TAF5L Peptide
MBS3226053-02 5x 0.1 mg

TAF5L Peptide

Sign In for Pricing
View Details
Lentiviral human ERCC5 sgRNA gene knockout kit - Lentiviral human ERCC5 sgRNA gene knockout kit (plasmid)
GTR15395348 1 Vial

Lentiviral human ERCC5 sgRNA gene knockout kit - Lentiviral human ERCC5 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
DDX57 (m) -PR
sc-156107-PR 10 µM - 20 µL

DDX57 (m) -PR

Sign In for Pricing
View Details
STX6 Polyclonal Antibody
UB-GEN-6129 100 µL

STX6 Polyclonal Antibody

Sign In for Pricing
View Details
CHIKV Spike glycoprotein E1 Rabbit Polyclonal Antibody
orb2950472-01 50 µg

CHIKV Spike glycoprotein E1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details