Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69-2 (HV692)

This Recombinant Human Immunoglobulin heavy variable 1-69-2 (HV692) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69-2 IGHV1-69-2

UniProt

A0A0G2JMI3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGATVKISCKVSGYTFTDYYMHWVQQAPGKGLEWMGLVDPEDGETIYAEKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cidea shRNA (UAS) - Lentiviral mouse Cidea shRNA (UAS) (100)
GTR15241854 1 Vial

Lentiviral mouse Cidea shRNA (UAS) - Lentiviral mouse Cidea shRNA (UAS) (100)

Sign In for Pricing
View Details
TIAL1, 1-375aa Human, His tag, E.coli
E53A04214 50 µg

TIAL1, 1-375aa Human, His tag, E.coli

Sign In for Pricing
View Details
Lenep sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3052503 1.0 µg DNA

Lenep sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
MAPKAPK3 Protein Vector (Rat) (pPM-C-His)
PV281129 500 ng

MAPKAPK3 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
SERBP1 (SerpinE1 mRNA Binding Protein 1, CGI-55, CHD3IP, DKFZp564M2423, FLJ90489, HABP4L, PAI-RBP1, PAIRBP1) (Biotin)
251509-Biotin 100 µL

SERBP1 (SerpinE1 mRNA Binding Protein 1, CGI-55, CHD3IP, DKFZp564M2423, FLJ90489, HABP4L, PAI-RBP1, PAIRBP1) (Biotin)

Sign In for Pricing
View Details
SINTBAD Rabbit mAb
C05899-100uL*2 2x 100μL

SINTBAD Rabbit mAb

Sign In for Pricing
View Details