Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-2 (TVB62)

This Recombinant Human T cell receptor beta variable 6-2 (TVB62) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-2 TRBV6-2

UniProt

A0A0J9YXY3

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GEM Interacting Protein Antibody
NBP2-30537-25ul 25 µL

Rabbit Polyclonal GEM Interacting Protein Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal ZMPSTE24 Antibody [DyLight 594]
NB100-2388DL594 0.1 mL

Rabbit Polyclonal ZMPSTE24 Antibody [DyLight 594]

Sign In for Pricing
View Details
Proteinase K, RNase/DNase free
P-480-100-100mg 100 mg

Proteinase K, RNase/DNase free

Sign In for Pricing
View Details
4- (Chloromethyl) -2- (methoxymethyl) -1,3-thiazole
SGA15554-01 100 mg

4- (Chloromethyl) -2- (methoxymethyl) -1,3-thiazole

Sign In for Pricing
View Details
4- (Chloromethyl) -2- (methoxymethyl) -1,3-thiazole
SGA15554-02 1 g

4- (Chloromethyl) -2- (methoxymethyl) -1,3-thiazole

Sign In for Pricing
View Details
PARP3 Polyclonal Antibody, PE-Cy5 Conjugated
bs-7108R-PE-Cy5 100 µL

PARP3 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details