Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-2 (TVB62)

This Recombinant Human T cell receptor beta variable 6-2 (TVB62) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-2 TRBV6-2

UniProt

A0A0J9YXY3

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5'-3'Exoribonuclease 1
544742 200 µL

5'-3'Exoribonuclease 1

Sign In for Pricing
View Details
HA Protein (C-His, H3N2)
P519469 100 µg

HA Protein (C-His, H3N2)

Sign In for Pricing
View Details
N-[2- (Fmoc-amino) -ethyl]-Gly-O-tBu hydrochloride
HY-W141923 1 Each

N-[2- (Fmoc-amino) -ethyl]-Gly-O-tBu hydrochloride

Sign In for Pricing
View Details
Urocanate hydratase (UROC1) Human ELISA Kit
I1551 96 Tests

Urocanate hydratase (UROC1) Human ELISA Kit

Sign In for Pricing
View Details
Tissue Inhibitor of Metalloproteinases 1 (Erythroid Potentiating Activity, EPA, Collagenase Inhibitor, CI) (MaxLight 550)
T5580-15-ML550 100 µL

Tissue Inhibitor of Metalloproteinases 1 (Erythroid Potentiating Activity, EPA, Collagenase Inhibitor, CI) (MaxLight 550)

Sign In for Pricing
View Details
S100A1 Rabbit Polyclonal Antibody (Cy7)
orb2423990 100 µL

S100A1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details