Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-2 (TVB62)

This Recombinant Human T cell receptor beta variable 6-2 (TVB62) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-2 TRBV6-2

UniProt

A0A0J9YXY3

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alexa Fluor® 647 anti-mouse Blimp-1
GT05201 25 µg

Alexa Fluor® 647 anti-mouse Blimp-1

Sign In for Pricing
View Details
Human PTK2B Pre-designed siRNA Set B
SI013114B 1 Each

Human PTK2B Pre-designed siRNA Set B

Sign In for Pricing
View Details
PCMV-UB-K48-3xHA-Neo Plasmid
PVT83031 2 µg

PCMV-UB-K48-3xHA-Neo Plasmid

Sign In for Pricing
View Details
DPP7 (H-8) P
sc-390008 P 100 µg - 0.5 mL

DPP7 (H-8) P

Sign In for Pricing
View Details
Porcine Desert Hedgehog Protein (DHH) ELISA Kit
MBS9357058-01 48 Well

Porcine Desert Hedgehog Protein (DHH) ELISA Kit

Sign In for Pricing
View Details
Porcine Desert Hedgehog Protein (DHH) ELISA Kit
MBS9357058-02 96 Well

Porcine Desert Hedgehog Protein (DHH) ELISA Kit

Sign In for Pricing
View Details