Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-1 (TVBJ1)

This Recombinant Human T cell receptor beta variable 10-1 (TVBJ1) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-1 TRBV10-1

UniProt

A0A0K0K1A3

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EITQSPRHKITETGRQVTLACHQTWNHNNMFWYRQDLGHGLRLIHYSYGVHDTNKGEVSDGYSVSRSNTEDLPLTLESAASSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRBP1 Antibody
GWB-6C3C67 0.1 mL

NRBP1 Antibody

Sign In for Pricing
View Details
Lentiviral human DOCK4 sgRNA gene knockout kit - Lentiviral human DOCK4 sgRNA gene knockout kit (100)
GTR15376759 1 Vial

Lentiviral human DOCK4 sgRNA gene knockout kit - Lentiviral human DOCK4 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
FucT-IV HDR Plasmid (h2)
sc-401795-HDR-2 20 µg

FucT-IV HDR Plasmid (h2)

Sign In for Pricing
View Details
BCAS3 Rabbit Polyclonal Antibody
TA315540 100 µL

BCAS3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATP6V0A2 Polyclonal Antibody, FITC Conjugated
A68224-050 50 µL

ATP6V0A2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
BAIAP2 Protein Lysate (Rat) with C-HA Tag
12997036 100 µg

BAIAP2 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details