Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 30 (TVB30)

This Recombinant Human T cell receptor beta variable 30 (TVB30) spans the amino acid sequence from region 19-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 30 TRBV30

UniProt

A0A0K0K1B3

Expression Region

19-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iodine Solution 0.025M (0.05N)
VM6666-B 100 mL

Iodine Solution 0.025M (0.05N)

Sign In for Pricing
View Details
TGF beta induced factor 2 (TGIF2) (NM_021809) Human Recombinant Protein
TP300773L 1 mg

TGF beta induced factor 2 (TGIF2) (NM_021809) Human Recombinant Protein

Sign In for Pricing
View Details
Funnel, powder, 180mm, PP
600166 5/Bag

Funnel, powder, 180mm, PP

Sign In for Pricing
View Details
DLL4 Recombinant Protein
OPCD02764-10UG 10 µg

DLL4 Recombinant Protein

Sign In for Pricing
View Details
CREG1 Protein Vector (Rat) (pPB-C-His)
PV261694 500 ng

CREG1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
PAPPA2 (Pappalysin-2)
488036 100 µL

PAPPA2 (Pappalysin-2)

Sign In for Pricing
View Details