Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 30 (TVB30)

This Recombinant Human T cell receptor beta variable 30 (TVB30) spans the amino acid sequence from region 19-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 30 TRBV30

UniProt

A0A0K0K1B3

Expression Region

19-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OCIAD1 (NM_017830) Human Recombinant Protein
TP301506 20 µg

OCIAD1 (NM_017830) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Dog Olfactory receptor-like protein OLF3, partial
MBS7094689 Inquire

Recombinant Dog Olfactory receptor-like protein OLF3, partial

Sign In for Pricing
View Details
PIGO sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1647908 1.0 µg DNA

PIGO sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
1- (2-furylmethyl) -1H-tetrazole-5-thiol
sc-332243 250 mg

1- (2-furylmethyl) -1H-tetrazole-5-thiol

Sign In for Pricing
View Details
RHOQP sgRNA CRISPR Lentivector set (Human)
K1821701 3x 1.0 µg

RHOQP sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Lentiviral mouse Nwd2 shRNA (UAS) - Lentiviral mouse Nwd2 shRNA (UAS) plasmid
GTR15198703 1 Vial

Lentiviral mouse Nwd2 shRNA (UAS) - Lentiviral mouse Nwd2 shRNA (UAS) plasmid

Sign In for Pricing
View Details